DPCstruct | MC8672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 265 ± 57 aa |
| Standard deviation of domain lengths | 56.84 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4WVL7 | 124-432 | LRGTAQVMFVNNPLSGLIIFIGLLIQNPWWTIAGVLGAVVSTLTALALNQDRSAIASGLHGYNGMLVGLLIAVFSEKLDYYWWLLFP… |
| A0A833Z8G9 | 589-845 | YNATLVGILMAVFSDKGDYFWWLLFPVCVLSMTCPVFSSGLNSVFTKWELPVFTLPFNMAITLYLSATGHYNPFFPTTLITPETSVP… |
| A0A3D3GDW7 | 27-322 | None |
| A0A0T5Z160 | 28-324 | None |
| A0A1L8QR02 | 4-238 | None |
| A0A3N7I4E7 | 17-211 | None |
| A0A1I5NR34 | 26-295 | None |
| A0A221R4I8 | 49-323 | None |
| A0A4W3HS94 | 79-350 | None |
| A0A6P3TG66 | 308-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.