DPCstruct | MC867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF15711- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3GGV3 | 155-311 | LHGESLEQMLKNAGPFSLIMMAVKDDGSQALDHEWQEKLHSVGIRALTRDHLRRSYVNILFKRSEFEFITLYEEVADRMIEVDYPEL… |
| A0A7U9RUB9 | 2-152 | LELEQDFVTYINMLANEYKDNTIFIVASDEMSQGLNEIDTNALRMLGLQTDYSIALQHSYIVVIENGKVKYEALSNRPLNYTGICQN… |
| A0A1I4IFS8 | 172-318 | None |
| K1VBH4 | 244-411 | None |
| A0A350IXB5 | 725-866 | None |
| A0A1I2RFT9 | 316-479 | None |
| A0A1M7T575 | 69-190 | None |
| A0A7X5ITL1 | 503-671 | None |
| A0A174C4P4 | 769-920 | None |
| A0A3D5MZ92 | 97-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.