DPCstruct | MC8669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 188 ± 24 aa |
| Standard deviation of domain lengths | 23.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645CS47 | 136-331 | VKQPVDFKAADLRTKLNTLIITAGEQQTMNFYMNLGNTYYNDLGRQLYLEIAMIEEQHVTQYGSLLDPGCTWLENLLLHEYTECYLY… |
| C4ZHZ8 | 14-214 | LFVDWEKFWVKPYNKNEVNPYTRTRIILMNGTEFENVWFSHQFSRSVGDDELRRKLAYIRKSEQQQQKILTHLKPADESALEHTIGY… |
| W0VA71 | 3-209 | None |
| A0A1V5QS92 | 28-240 | None |
| A0A7C5FE13 | 185-398 | None |
| A0A353WIQ3 | 2-161 | None |
| A0A7V1H1I2 | 16-161 | None |
| A0A1Y6JJD1 | 1-194 | None |
| A0A0W8FJT9 | 72-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.