DPCstruct | MC8668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0RU60 | 141-235 | SVSFMETEVMGAKSPLYGRSTSNLELQSFDYLQSAAFFPNYSNEEKLLSYGILGGIPCYLEAFSDASSLPQNIAQNILRMGSFLKDE… |
| C4ZHG0 | 11-103 | KALMERQNPLYGRIDLTLNLKPMDYYDSALFYPEFSEEDKVRLFSVFGGISYYNRLIDAQKSVRENIIELIASSGARLENEVAMYLN… |
| A0A3G8W4B3 | 3-92 | None |
| A0A4R0P395 | 16-112 | None |
| A0A1F3XWD2 | 16-111 | None |
| K2D615 | 38-131 | None |
| A0A161XHT9 | 72-170 | None |
| A0A1V1NVS2 | 27-115 | None |
| A0A1V1P038 | 54-146 | None |
| A0A2V2S0Z4 | 9-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.