DPCstruct | MC8667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 22.46 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9I7K1 | 21-169 | KVRFDESRIVAYAESMSKNYTEADVAKLTELTTHNAKSKTALLGYYEANSVTSYEQIAHQNKLTYFEAGSDGWNAMSNIDPDLAQRV… |
| C4ZCM0 | 64-209 | TRTEILSSEEAEEIAFNAIQGADKADTVVLGKFDALKDANENFVYDANGNLIPTDKSYNKVAEQMGAQYFQLDNWDELAAKYDDNEI… |
| A0A840LU61 | 124-239 | None |
| A0A840LR80 | 307-493 | None |
| A0A4Z0HIB6 | 5-115 | None |
| A0A4V3G631 | 45-193 | None |
| A0A1H6L9E5 | 5-114 | None |
| A0A840RPG7 | 250-375 | None |
| A0A2W6VP15 | 303-443 | None |
| A0A7I7WQ42 | 16-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.