DPCstruct | MC8665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6I210 | 5-114 | SPGAQQTALETLKNHARKYRRRGISEFRGHFKANMLFVYVVKKAKSGLVGRVFGMSNVKGVGRLARLEYLDPDKWKLLIFKFDSKKY… |
| A0A0A8EBA7 | 4-104 | NPPESMQHHLRQRLNAHAAERWPQLARVHVRFRTGFAYLAGELKDGERVPLCRLRFTGVLHTWGFALYQAGNDSYRDGILPSGLPAG… |
| A0A538KVL8 | 15-127 | None |
| A0A6F8YLM5 | 50-150 | None |
| A0A3M1WTN3 | 5-112 | None |
| A0A177JWE9 | 7-93 | None |
| X0Q0B5 | 2-77 | None |
| A0A062WQA7 | 3-103 | None |
| A0A3D4RUN0 | 12-94 | None |
| A0A1F3ZAX8 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.