DPCstruct | MC8664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1100 |
|---|---|
| Mean domain length (aa) | 232 ± 45 aa |
| Standard deviation of domain lengths | 45.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 99.08 |
| Assigned Pfam label(s) | CL0287- PF07589- CL0056- PF13271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655PVW1 | 2-135 | CVSQNDAKAYARWLSKETGFTYRLPTEEEWEIAARAGSKTDYWWGNKFGAGKANTGWAGTSWSNKSTSPVKAFAPNALGFYDMVGNV… |
| A0A2E6CHV5 | 6-230 | VKPGRFTMGTSGSEVGRGEDEGPHHEVVLTEGFYMGKYEVTQEQWIAVMETVPWLGEDFLQLGPDYPAVYISWQDTQDFIRALNITA… |
| A0A2G8LNU6 | 216-500 | None |
| A0A1V5ZAL4 | 234-451 | None |
| A0A7C1PP97 | 46-250 | None |
| A0A2D5UEP7 | 670-926 | None |
| A0A1Q6TYB8 | 269-451 | None |
| A0A518I0X5 | 19-232 | None |
| A0A3L7PH20 | 31-352 | None |
| A0A850KGV4 | 596-844 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.