DPCstruct | MC8663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 342 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 12.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 16.67 |
| Assigned Pfam label(s) | CL0342- PF15436- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6CGN0 | 14-110 | AVPTEAGEALITRVRGSVLTIDAGAEAGIIKGLSVNIVRPPGEAVIHPITGENLGAPELVIGRGEISKTSNRAANVQVEPGLLLSVR… |
| A0A6G3LJL7 | 20-111 | LKESLKAFFEREGYVLKVEGNKILVDIKDLKKGEELVLFREGKEVIHPITKQSLGKELEKVGKAVVEEVGQNFSVARLVEGKDIKAG… |
| A0A0D6EW76 | 365-441 | None |
| A0A0K2XT01 | 12-109 | None |
| A0A833P3K0 | 98-189 | None |
| A0A356PH47 | 96-196 | None |
| A0A160N522 | 446-539 | None |
| A0A259LMA2 | 2-82 | None |
| A0A3M1IK07 | 23-117 | None |
| S2XM48 | 4-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.