DPCstruct | MC866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 274 ± 38 aa |
| Standard deviation of domain lengths | 38.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.28 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0192- PF05571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3F6L7 | 12-294 | YCGRTLLENASLSECGACARGFRVNANDYVCTPCEADLSEHDWLYLGFMAILPLIIHWFCIDLNAQQRRFSRGELILHASACVEVLL… |
| T1J971 | 157-439 | SPLTSCPGYYCGRTFLGNGTWSSCRACPRGFRVNSSTSECIQCTTSPQFYDWFYLAFMAFLPLVLHWFCIDLAAKRRSFTQAVLVLH… |
| K7FCW4 | 2-235 | None |
| A0A183LTJ5 | 25-345 | None |
| A0A7R8H1G6 | 34-264 | None |
| A0A817QDA9 | 1-231 | None |
| A0A4Y7NIP8 | 623-839 | None |
| A0A2A2K4L1 | 340-621 | None |
| A0A4S2LNU4 | 21-365 | None |
| A0A183K5P8 | 53-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.