DPCstruct | MC8657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 178 ± 28 aa |
| Standard deviation of domain lengths | 27.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 40.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1WLF9 | 213-349 | LVALFDDQVHDSRAWFMNSDPVMGPREPFTDYFRIRLVHFDNESNKQLSLLATAGRVIGVGIALASIGLSIKKKDPRMLLGLFLPSL… |
| A0A6I6B1C3 | 6-164 | RELLESADGLLMALFDDQVHDSRAWFLHASLGSREPWGSYFRYRMIYFGDKCSKSLAALVVDGKVPGMVTQDEPVLLRFRVKSDRDI… |
| A0A378F478 | 4-196 | None |
| A0A198GK21 | 543-769 | None |
| A0A653RSE3 | 577-740 | None |
| A0A0N0GPG6 | 215-403 | None |
| A0A2V0R1S1 | 1-162 | None |
| A0A2V0QS43 | 108-304 | None |
| A0A377TR63 | 294-499 | None |
| A0A0J8YAR8 | 225-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.