DPCstruct | MC8656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 15.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2MD34 | 310-441 | GAVDTVRIGQATGVAPHLGLNLLLSGVRLGAGTAADVSLRLVEHHARPGLALFDTADGHRPLARWEPDGEEGGRAFVLLVPEDGASS… |
| A0A502GJA8 | 318-481 | SAPSDPREVAAPEPPAVAPNADDAVAATQEGVRLKGYEAEGPHRHLDLETRSLAAGAEQWPLVRVNIAPGEGGPRLEFRLGAEWPPV… |
| A0A1P8EZ90 | 475-619 | None |
| A0A3S2VUZ5 | 415-567 | None |
| A0A2S7JMR2 | 682-841 | None |
| A0A261WDD7 | 214-368 | None |
| A0A1I4BJX1 | 42-230 | None |
| A0A2D5PFQ8 | 223-405 | None |
| A0A2D5PFQ4 | 658-827 | None |
| A0A840YHL9 | 595-764 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.