DPCstruct | MC8655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3HKX1 | 9-142 | ILHHYFMQASIMRELVKACQKAGAPWLEVLDELPEKSEFRDQLVAMEFMRVISIWYAMLYVVIEGYRELKLVDGQLDSLLASKNVDQ… |
| A0A502F9K6 | 1-165 | MDEDERHEQWVDKLVALHQHWTTAEAIGDHLRRSMLHKIRHGPRELTPEEYWADTTYQRSVMLAVCVHHSLLYVVIEGWRELGCVDT… |
| A0A7H8DN12 | 2-127 | None |
| A0A7W8ILL3 | 18-154 | None |
| A0A1F2SZC9 | 10-150 | None |
| A0A285I7G1 | 1-129 | None |
| W0RQW5 | 89-241 | None |
| A0A1F7IY49 | 1-145 | None |
| A0A845MDU2 | 7-141 | None |
| A0A1F6QSL7 | 19-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.