DPCstruct | MC8652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 155 ± 27 aa |
| Standard deviation of domain lengths | 26.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1MEY9 | 8-190 | KWNSRFLNKVPIPYLFKYYFSDSWLRLYNFADSKRYADDPIQMDILLKHQNQIIDDCLNSASPIFIVSGNSFIGDSKIPIYDQVSML… |
| A0A511V0Y2 | 7-207 | FQKTIVEMGMPILEHPIFYKAPVGIRFDIGGEDDVYIKKGLMRKLYPNPVYVNEAVERALAIFRAFPPKNWLLRIDLYSEQEIKKTV… |
| A0A0Q5GKF9 | 6-106 | None |
| A0A265Q8T5 | 20-204 | None |
| K9PZ26 | 13-172 | None |
| A0A2N5D9Y0 | 11-192 | None |
| A0A4Q3PG05 | 1-95 | None |
| A0A7Y4P1P9 | 14-127 | None |
| A0A1Y4WNE6 | 17-199 | None |
| A0A348Z083 | 182-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.