DPCstruct | MC865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 222 ± 29 aa |
| Standard deviation of domain lengths | 28.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182G1J1 | 161-402 | GGMVLRRRSRSTHEDLSRVTSAKEHLLARFEAIFDMAGLVQLYAEYLRIHRSEVLRAGPSQYQDRSSSDPKLHAAHVTRVQISQRVE… |
| A0A1Q3EUY2 | 11-221 | LVTTFKRAAINADSTPSSEDQNATTSIEDHFEERLTRFIHLGGFAQSIAKEEDRVGRVDRTWTKVPRSEVFLVGSADLPEDSSDYDR… |
| A0A182IT08 | 25-244 | None |
| A0A182VYZ4 | 306-495 | None |
| A0A0E4C779 | 206-422 | None |
| W5JKZ6 | 222-426 | None |
| A0A182VPH7 | 40-240 | None |
| A0A182IBC4 | 276-491 | None |
| A0A182IF16 | 146-379 | None |
| A0A182SZS7 | 393-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.