DPCstruct | MC8647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A076N3Z7 | 147-266 | VVGTFNYVKLPMVEDLANATELLTSHDLVAALAGFEPAKQALIADAGEFRTPGVDELDPADEYLVQDADSSQHRAIMTALGGQHLLV… |
| A0A1D3DN33 | 1-136 | MKERVVLGLFASHREAKYQDLQQNQERILGHPLVRAIALGPDAELPDDVAGFEPPDPDRIDEVQMPERTPLVLDADASQRQCVGAAL… |
| A0A7K2E6H5 | 218-334 | None |
| G8B172 | 628-734 | None |
| A0A4Q3WFS8 | 267-387 | None |
| A0A1X7MGT4 | 296-408 | None |
| A0A433J5T8 | 434-548 | None |
| A0A842K2A5 | 58-183 | None |
| A0A0D8HHL2 | 1-124 | None |
| A0A6M4JAZ2 | 176-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.