DPCstruct | MC8645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 196 ± 16 aa |
| Standard deviation of domain lengths | 16.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3AGQ9 | 2-185 | NTNEAKEYLAKRDVPQLFESLLTGLMYYRPDDPIEYLDNCLRKVKELGGTEKIRWDTFVGQEKRTLPPLNGGQLRRSFFRNESDSDL… |
| A0A4Y2FNY6 | 1-228 | MFQPQPPAGQRRHRRLPSGTVVSYAEVKTYLSKREIPQLFESLMAGLMYHRPENHIGYLQTCLDEVKTNSETKVHWSTFVNKKRKSK… |
| A0A310UDX7 | 1-194 | None |
| A0A6J0XH88 | 4-201 | None |
| H3BAZ9 | 4-201 | None |
| A0A0M3K0Y6 | 1-181 | None |
| A0A7J8F606 | 2-209 | None |
| F6SPL9 | 4-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.