DPCstruct | MC8644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 3.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.98 |
| Pfam Score | 87.64 |
| Assigned Pfam label(s) | CL0487- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0J865 | 3-80 | KDERYTIQDLLEHSFFQEDTGVHVELAEEDDGVKSGLKLWLRMDDTKKLHGKYKDNNAIEFLFELYKDVAEEVAQEMV |
| A0A226PLZ8 | 28-107 | QNKGERYAIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMV |
| A0A0D6MAR0 | 126-207 | None |
| A0A132AHN9 | 197-274 | None |
| D3ZMJ7 | 441-517 | None |
| A0A7R9EJ87 | 24-107 | None |
| A0A7J5ZEU9 | 3-73 | None |
| A0A5E4BXM5 | 440-517 | None |
| A0A5B7D560 | 1-86 | None |
| A0A7R8HD22 | 492-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.