DPCstruct | MC8643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 2.55 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0EGX4 | 4-65 | WCGKNLRDIQGWKEDGLDTTIINNETAKLFDASVRQLVSLRDCDQLGGFVKTMTNMLNNEPD |
| A0A4Y2FH20 | 3-62 | QFWRGVSEWQKEGLHLSSASDQACKLYDAAISQYVGWYEEPSLGGISKTVQEMISIDPNF |
| A0A2B4RFE8 | 1-61 | None |
| S7NSQ7 | 8-69 | None |
| A0A812EU13 | 3-65 | None |
| A0A368FCR0 | 1-65 | None |
| A0A4W2HGH5 | 1-66 | None |
| A0A815JK31 | 3-63 | None |
| A0A6S7H0S4 | 7-68 | None |
| A0A368FT99 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.