DPCstruct | MC8642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2FD48 | 8-106 | RPLLSGGFGCTKLRTKIVERNTGKVAQTCFSNEPVAECAPHCKARATTSKKISFHCLPAKDDSTKALVRQQPLRVLHEFRRKSKDHE… |
| A0A7D9I465 | 631-717 | KLKGKHMKLTTGAPEGKVCFTIGRFLRCVAQCTAGQKHQFEKVAYHCLAANDPLVARIQAGDPTVALETRSVDTWGPVEEHLTCQCN |
| A0A2H2IZF9 | 1079-1172 | None |
| A0A368GGN3 | 122-219 | None |
| T1L4N7 | 86-192 | None |
| T1L5P9 | 699-807 | None |
| A0A2A2KL47 | 81-191 | None |
| A0A4Y2IWY4 | 1-80 | None |
| A0A6G6PJJ3 | 28-116 | None |
| G3P5I3 | 807-891 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.