DPCstruct | MC8641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 185 ± 31 aa |
| Standard deviation of domain lengths | 30.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10152 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0W0B3 | 1-137 | MNVEELSMIGPNVDLETVDPINKKRLLAFVNHYIVNTALFLNNLSKSYEQGLMTLENKIQKLESSIIMLEKRVIDKSQDDNNNDKEK… |
| A0A4Y2F4Q1 | 5-172 | GLPIVGSGVDYSKVDPLNQKRTLTFLNHFLIRTTSFLNHFSSVCDEKLENLLIRIQRLEASMCILEAKLASIPGLDDVAANVESTEP… |
| A4S9P5 | 2-155 | None |
| A0A024G717 | 19-240 | None |
| A0A2P6P0J8 | 1-192 | None |
| A0A835NLX4 | 7-177 | None |
| A0A7E5VVM7 | 14-168 | None |
| A0A2I2YL20 | 1-168 | None |
| F4Q1Z4 | 1-226 | None |
| A0A5B8MYY1 | 176-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.