DPCstruct | MC864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835VI23 | 7-100 | VDNMQDEDSEWLSSLTEHELDFLISLKELATTKAKNIGRKDLSKKFDIKVLRALGFILLEYFKERVRNTPAISDADELLASLNNSGL… |
| A0A6P5NP71 | 7-118 | DSRLEVESLIWLCSLSELEIDMLISLKLLIFQRAKTVGYADLAKKFNLKIIRAIAVVLMEHLKEELKDLLLVADTDKSASFLDACKL… |
| A0A2J6KMQ5 | 2-122 | None |
| A0A7N0UDH0 | 5-118 | None |
| A0A830CPJ9 | 1-116 | None |
| A0A2J6KG15 | 4-128 | None |
| A0A445BM03 | 209-362 | None |
| A0A0A0KW48 | 180-291 | None |
| A0A0A0LBP9 | 61-173 | None |
| A0A6B9V7H4 | 7-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.