DPCstruct | MC8639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2E3K1 | 1-94 | MPYLKAILVNATDKSNCMLRAKSMECISLVGMAFGKEKFRDDAKQVMEVLMSLQGSQMETDDPTTSYMLQAWARLCKCLGQDFLLYM… |
| A0A7R9FKW4 | 99-191 | LKYIISNANTEDLKMLRGKAIECVSLIGLAVGAEKFMRDASEVMDMLLKTQTEGGDLPDDDPQTSYLISAWARICKILGKQFEQYLP… |
| A0A3P6PZX1 | 1-104 | None |
| A0A1S3Z530 | 201-299 | None |
| A0A2G5EE12 | 546-673 | None |
| A0A6S7PJ85 | 1-129 | None |
| A0A453B886 | 13-138 | None |
| A0A0D6L7A5 | 91-197 | None |
| A0A0R0KHK7 | 211-334 | None |
| A0A2S3IJK5 | 541-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.