DPCstruct | MC8635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9KKV5 | 69-190 | ENHHRGGCMPYYDFRCNTCHKRFEAFLSYAEFDQKKVRCPHCNSENLTRLIRRVRISRSGSVSLESLDDDQMLEDLEQDPRKLGRMM… |
| A0A3M1XHF7 | 1-135 | MPIYEYRCRDCGRTFSIFWRSLSAVDEKGARCERCGSRRLMRLASRVRVVRGAGSSDFDAGGGDDALLDEMAGLDENDPRALGRFMR… |
| A0A117LH45 | 1-123 | None |
| A0A1V5KN30 | 1-154 | None |
| A0A4V0WUN9 | 5-173 | None |
| A0A2M8PIT2 | 2-136 | None |
| A0A7C0U144 | 11-141 | None |
| A0A535N3I5 | 221-342 | None |
| A0A5N9AGM4 | 7-118 | None |
| A0A661W0W3 | 68-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.