DPCstruct | MC8634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 148 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1QS52 | 46-213 | QVSGTTTPVATDNLTPTAPPTPDPFPTPTRLQIQIAEQLFEHGRMFWLQPTKEIWVLKITDETGGTWEVYEDLFEEGDVEFDPDIIP… |
| A0A661VNL8 | 120-259 | NAKPDILLALGCPTGERQQTWAAEERFQHGRMFWQQDTDMIHILYDDTGTFQMEPDQYVEGDPEDACPEVGDAPAGLFKPVRGFNWQ… |
| A0A521UCX6 | 496-640 | None |
| A0A2E0L7K4 | 257-388 | None |
| A0A2M8PU32 | 298-440 | None |
| A0A2M8Q1S2 | 86-259 | None |
| A0A6L9J208 | 170-345 | None |
| A0A3M1Z5X5 | 102-231 | None |
| A0A1V5YLU1 | 496-656 | None |
| A0A2W4PJT3 | 18-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.