DPCstruct | MC8632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 20.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 65.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF04121- CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2JH95 | 155-342 | MCPDATVCAALMSALYSSATEEVVSERQLTVNVAISSKDSYSIEVILRCLAVEGDGIGPHILNDGGLLSAVMAAGFKGELARFQAGV… |
| B4FPH4 | 19-192 | VSEDDVLHRLLKVDVQVSSRDPCCIEVALRCLAAEGDGYGLHEANDGGLLAAVMAAGFKGELSRFQPGVSMAISRLDAWYSDRSGSV… |
| A0A2G9HUX7 | 29-183 | None |
| A0A452XR19 | 91-278 | None |
| A0A7J0FGA9 | 684-861 | None |
| A0A1D6PPH2 | 2181-2372 | None |
| A0A4S4D300 | 139-302 | None |
| A0A835PZ24 | 53-214 | None |
| A0A3P5ZS87 | 332-531 | None |
| A0A2P2K3Y0 | 43-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.