DPCstruct | MC8630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7Z6H5 | 61-213 | SNPIETRDGVTLPSYQGDIINHDDFDEKSRAPNPQRLIRAYSQSASTLNLLRAFAHGGYADLQRVTEWNLDFLRHSTQGDRYVELAQ… |
| H6SRE3 | 559-712 | SAPFETVEGKELPSYRGDMVNAMDADLDARIPNPDRLLRVYHQSAATLNLLRAFAQGGFAHLAQVHEWTLGFVQGSPQAERYGAFAD… |
| A0A7J9Y6F3 | 33-156 | None |
| A0A444BT89 | 590-743 | None |
| A0A4Q6BU84 | 1-119 | None |
| A0A452YVE1 | 97-249 | None |
| A0A6A3AGS2 | 118-249 | None |
| A0A4D8ZQ53 | 185-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.