DPCstruct | MC863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 472 |
|---|---|
| Mean domain length (aa) | 173 ± 38 aa |
| Standard deviation of domain lengths | 37.56 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 84.71 |
| Assigned Pfam label(s) | CL0023- CL0028- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5NIL0 | 7-176 | KESNLQSVEIVDEFICVELPNPLKFPALYNVVTKYMIHGPCGQLRPSSPYMKDGKCSKFYPKRFVDQTRFDEDGYPIYRRRNMGVTV… |
| A0A2S2R808 | 2-97 | IDKFVCAEIPNPDVDPLLYEIVKANMIHGQCGLLNKNSPCMKGGVCSKRYPVTLIQETQRGEDGYPKYRRRSTNDGGFKVSIESIDL… |
| A0A5C2SKM6 | 41-185 | None |
| A0A284RAN5 | 818-1027 | None |
| A0A146H3V4 | 714-912 | None |
| A0A4Y2CYN3 | 2-160 | None |
| A0A1U7Y1G0 | 354-468 | None |
| A0A4Y2CC74 | 44-185 | None |
| A0A4Y2CC33 | 3-154 | None |
| A0A6V7PWG3 | 27-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.