DPCstruct | MC8629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0N328 | 88-191 | GDHHSANGGSDSGFKHCVSVIRQLESLGHIDKEFRQKFLTWYGLRATPQEVRVVKIFIDTFSDDPMDLAEQLVHTFNDHVLAKRCSA… |
| A0A453SRX1 | 169-257 | GKPEDAARTDADAYVYCVKVIRWLECEGYVEASFRVKFLTWLSLRATRHEKRVVSVFVDAFIDDPASLAGQLRDTFSEAIYSKRPPM… |
| A0A6D2K6V6 | 580-688 | None |
| A0A7I8J890 | 482-583 | None |
| Q9FIE3 | 512-620 | None |
| A0A835K739 | 407-511 | None |
| M1CMC6 | 238-348 | None |
| W1PJP6 | 672-778 | None |
| A0A1R3ICC6 | 400-497 | None |
| A0A251UK38 | 300-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.