DPCstruct | MC8628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 165 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 52.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843VNG9 | 387-553 | EDSAESARLVIGRKLQFQVKDACLEDKHYKQEEEEQFVTLIRFTQENPEGRATALLNWNLLAVEFLPEEDAVFVLLLCMAVVRTISE… |
| B4FD33 | 27-185 | YQARLLVGRRLSYRVNTDNASSNLVEEEQYLTLVRKSPYHHGDRATVLLNWKLLAVEFLPEEDAVFVLLLCMVIARTMTEIRREDVA… |
| A0A287WH17 | 111-275 | None |
| A0A287WH03 | 151-319 | None |
| A0A834LGV6 | 581-758 | None |
| A0A816XWE7 | 1-153 | None |
| A0A835R0I1 | 4-151 | None |
| A0A2C9VBW7 | 197-346 | None |
| A0A0A9MPS7 | 75-235 | None |
| A0A7C9EBI7 | 4-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.