DPCstruct | MC8626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 219 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3CDS3 | 2-206 | PLDNNGDCSLTELISSILDRIPNLLSFKSKWSSIRVKLADLNPHLSDIAASSSSNQLALDLLLSARETLHDAASVAARCEGPNLSEG… |
| A0A804UN10 | 4-196 | GSKAMLAKPIQLADQVAQQAGWQCLRADCTELQSRAMKLAELLRQAARVELYERPATRVMVDTEGALHKAAGMAALCFQSHSCLRRF… |
| A0A7J0EQF9 | 7-234 | None |
| A0A6P5SRQ3 | 313-548 | None |
| A0A7J6DJQ9 | 10-233 | None |
| A0A811PE61 | 4-205 | None |
| A0A816JSS4 | 1-260 | None |
| A0A6J5XWY5 | 38-267 | None |
| A0A835PPG2 | 35-227 | None |
| A0A6A5MKI2 | 4-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.