DPCstruct | MC8625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 60.31 |
| Pfam Score | 32.50 |
| Assigned Pfam label(s) | CL0363- PF10597- PF12134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804UGX9 | 13-133 | AHRWQMSKPSLVSESKDVFDQKASNKYWIDVQLRWGDCDSHDIERYTRAKFMDYTTDNMSIYPSPTGVMIGIDLAYNLHSAFGNWFP… |
| A0A251RY15 | 149-276 | MNSSCADILLFATCKCSMSKPSLVAESKDVFDQKESNRYWIDMQLRWGDYDSHDIERYTKAKFVDYITDNMSIYPSPTGVMIGLDLA… |
| A0A1D6FVM4 | 808-925 | None |
| A0A7J7LUI9 | 90-208 | None |
| V6TU29 | 303-453 | None |
| A0A7J7M2I3 | 9-88 | None |
| A0A2P8XJN9 | 840-947 | None |
| A0A446MUL0 | 87-205 | None |
| A0A7S4PR46 | 544-673 | None |
| A0A822DI53 | 16-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.