DPCstruct | MC8623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7G3Y0 | 66-162 | FVEGLQANLEATTCTATNGCGVHIHSGTSCFNSTTQGGHYFESPVTDDPWVEERYSSDETGFALFSSVAVIGTSNLEGRAFVVHAED… |
| A0A7S2TDB1 | 2-98 | FSVRNMVPNTKVFAHIHEGVSCEQAGGHHWNASQTKTDFWNAGPTVTADQDGNAMGGLDVSRQEGGFPFSENILHAVVIHNNNGTRV… |
| A0A7S0HBU3 | 254-384 | None |
| A0A7S2ELA8 | 198-289 | None |
| A0A7S2PXW6 | 1-108 | None |
| R1BQ15 | 409-522 | None |
| A0A813F2Q1 | 1-102 | None |
| A0A812RH98 | 181-302 | None |
| A0A7S2RBB6 | 100-190 | None |
| A0A813IGX2 | 164-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.