DPCstruct | MC8622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 20.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8D9Y9 | 41-165 | PEYPFEWTGVYQLEPGHYEMTLEEGPDPEMSLVAIPGQKADEDALKQSAEQCVRLFAQSAQSLKPGDSIAPNQHLSLELDSKGTKSF… |
| A0A7S4BMF6 | 7-176 | RRTSTSWMAAVPPRGFFMGKPLLCIYLVGCLGTVASQGLHWGAIFPTGDSWYTLQLQKNSQTGMYANTTAGLVVLLAEDGRSVEELL… |
| A0A7S0EFY5 | 134-304 | None |
| A0A7X3T5E5 | 1-137 | None |
| R1CSF9 | 2-134 | None |
| A0A2E3X1P9 | 580-736 | None |
| A0A2D6ZKL6 | 2-126 | None |
| A0A2N2C9M5 | 126-257 | None |
| R1FJR7 | 2-115 | None |
| C2BFU2 | 138-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.