DPCstruct | MC8619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 217 ± 14 aa |
| Standard deviation of domain lengths | 14.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1SC97 | 1-191 | HGVLSEDGMVDSFAEFHPSAQERFTCWDQYRNRRHENLGSRIDYVLVDRPFFQQHAHRGTDLDTRGSAPPDSAAAALSATTLGGLSQ… |
| A0A1Q9CR13 | 811-1022 | EELEVEGSLPHRVREAPCVDWLLALVSESSEGSETEGKAFVDTFALCHGAACLGRYTQWNQLANSRFSNTGARLDYILCDTSMQKHL… |
| A0A7G2C312 | 428-658 | None |
| F2UNJ6 | 468-702 | None |
| A0A7S0ZYG1 | 319-522 | None |
| A0A7J6N4Y9 | 181-405 | None |
| A0A7S1VNJ4 | 129-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.