DPCstruct | MC8618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4B186 | 29-162 | WTASCAHNQTMQNPPISSGGIDVVAPVRAEPRAWLANERTFLSWMNAASTLVVVSSGITAAADTPIIRLTGVMLAAPGVVFVANALM… |
| A0A1Y1VQ33 | 15-139 | IIHTGPNKPIAVPLRVEPKVYFANERTFLSWTYTSVLIAGLSLTILAFGDTLSRVGGAVFSSVGVIFMTYALVQYERRLRMIRRKDA… |
| Q5B2T7 | 616-727 | None |
| A0A076LMS3 | 2-119 | None |
| A0A146F284 | 148-293 | None |
| A0A7S2RWM5 | 51-211 | None |
| A0A061QWJ2 | 24-201 | None |
| A0A1M7MYA7 | 3-129 | None |
| A0A4U0W7F8 | 158-278 | None |
| A0A7S0YMV3 | 13-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.