DPCstruct | MC8615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 154 ± 31 aa |
| Standard deviation of domain lengths | 31.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF06331- PF14966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4XXR3 | 2-134 | FYHLQSERVETYQLFEEGHEAYLRTGPQYDFDHYRQLVHEITQAFCGISKEVLEIKGRLHHEFDRPDLSEHIEKLQSKEKQKLELTA… |
| A0A0C9RRW7 | 6-196 | MDIEEEAPKPVELVDLLRRFLAVQKNRAEIYARLKRGFTEYLRTGSEHAYQHLCSEITTEFNDCSKRVIEMESILGSSDYCRDDLVN… |
| A0A2T7NS17 | 2-106 | None |
| F0WX89 | 22-196 | None |
| A0A4P9VYP9 | 10-148 | None |
| A0A7S4CMI5 | 6-151 | None |
| A0A1Y1VBM2 | 16-154 | None |
| B6JYL4 | 1-151 | None |
| A0A835XWE0 | 68-224 | None |
| A0A7R9YCH0 | 32-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.