DPCstruct | MC8614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 18 aa |
| Standard deviation of domain lengths | 17.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8FIG6 | 2-131 | RQVLQNFDTSASKQETLGQCQTLQDLCFAASIRQKSGLLHLGNTTATANELVRLLNLPTNSLLRQEICPDGAKVRMRDIHHYARFGV… |
| A0A1E3G7T6 | 1-157 | MEIEEVTQEELLLRTKQVLQILTSESKKSLFNQCKTLKDLCFLASIQQKRDLLFNTTTMAENLVYFLNIPANALLKRKICPNGEEVR… |
| A0A3M8FFK0 | 1-116 | None |
| A0A3M8FHN1 | 618-765 | None |
| A0A3M8FFI5 | 98-205 | None |
| A0A1L6TFQ7 | 357-512 | None |
| A0A1L6TFA7 | 276-408 | None |
| A0A0K2DZ27 | 7-114 | None |
| A0A0K2DVM2 | 167-315 | None |
| A0A177W1I7 | 135-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.