DPCstruct | MC8613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 36.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368X5U4 | 39-115 | PFEPRFEWDESSIFALREGLLWDSLRVLADGRAGEAAKQEAEDWMMSDEIHPFSFVVCCNELGYVPAELREQTRDLI |
| A0A1E3G6T4 | 1-96 | MSLAQRYFEEYQLVLPLEEAIEWTDEDVFKLREGMLYGALSALADHRTARQSVKEALAWVLSTEKHPFSFCVCAEMLGFCADELRDL… |
| A0A7Y4BSR4 | 7-85 | None |
| A0A2X2BYR1 | 15-103 | None |
| A0A5P1MST1 | 22-107 | None |
| A0A0D5MA97 | 64-140 | None |
| A0A6S6Y197 | 15-103 | None |
| A0A097J0I8 | 42-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.