DPCstruct | MC8612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 187 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7SXJ7 | 2-181 | AVLGDDGRWHLRVDETLVCGENPRRRPRPAEQGRFGHEQWCYWWTDGAAYRVQAPLVSSSELPAGSVWRTVRWTFTLTDTVTAPELV… |
| A0A2W2EKB3 | 194-381 | HPGSAQDLTAVLGSDGRYHLCRDNGPVCASKRRRSDGASGYRHEQTVRWWVSSIGYHTRLRLGTTAVRHERIVQWQVELTQASIDPA… |
| A0A7Z0V2B5 | 193-391 | None |
| A0A3N4S8A8 | 56-211 | None |
| A0A7J5DEY3 | 56-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.