DPCstruct | MC8611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 297 ± 21 aa |
| Standard deviation of domain lengths | 21.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J3E2N0 | 47-356 | IINIEIPSTKGLDAYPSVTEAFQTNMTSMECGLPTLLSFTARELADGTLFKAIEDYDPDSKRMLHQLKKLYHDDPVMNPLTPWERPP… |
| A0A287UPW2 | 141-409 | TTLVSIEVPTVRGTDAYPSIMDITEDITSNMECGKPTLLSFSAREVSDGTLFKTMLDYDPQSKALIHQLEKYYQGDPVLNPLTPWER… |
| A0A3Q7XNS2 | 219-538 | None |
| A0A058YZW3 | 550-832 | None |
| A0A6P6A124 | 1-291 | None |
| A0A067BW59 | 678-944 | None |
| A0A164Z3F9 | 202-496 | None |
| A0A080Z384 | 94-403 | None |
| A0A1Z5J8H2 | 536-804 | None |
| A0A5E4FCT9 | 150-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.