DPCstruct | MC8610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 74.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1AIZ3 | 117-192 | LDVVLGFSFGASALALFAKAGGGIYTKTADIGADLVGKVELGIPEDDPRNPAVIADNVGDNVGDVAGTGADLIDSY |
| A0A1J3DA04 | 1-78 | MFEAIAGFGLGGSTIALFARVGGGIYTKAADLGSDLVGKVESNLPEDSPKNPATIADNVGDNVGDVAGMSADLFGSFA |
| A0A7C2AEV6 | 7-81 | None |
| A0A662MHL3 | 257-327 | None |
| A0A7C5EPS5 | 33-105 | None |
| A0A7J0CTF7 | 220-291 | None |
| A0A7C7QPS0 | 27-101 | None |
| A0A3C1ERM7 | 188-262 | None |
| A0A7J9E350 | 141-216 | None |
| A0A5N5K5B9 | 329-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.