DPCstruct | MC861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8JKR0 | 2-80 | LKQYGIRLTANQAYHQMVKLGIVEQRERYSRTAINNIKKFWSLTAKGCMFGKNITSPANPRETQPHFFESRFPELLKLL |
| A0A4E0QMR7 | 2-80 | LKEHGSQLSAKTANNILIELGILEIQSRSSTSQGTKYFKCLTERGLEFGKNLVSPHNQRETQPHYYLARFPELLDRIND |
| A0A707F5S6 | 152-235 | None |
| A0A653KXY9 | 8-90 | None |
| A0A1A9ZYT2 | 252-334 | None |
| A0A7G9RJF0 | 20-121 | None |
| A0A6S7B936 | 228-332 | None |
| J1FBN1 | 187-281 | None |
| A0A173V6R9 | 56-139 | None |
| A0A0K4CB61 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.