DPCstruct | MC8609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | CL0296- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8NXB0 | 8-102 | ITPLKNKVLVKTIEKGEQLTKGGLIIPDDDGKDRGIRPRWAQVYRIGKHVEFLKEGQWVLVEHGYWTRGFTINTGAEKFDCRLVDND… |
| A0A836C6N2 | 27-132 | RANAQAEDVPELQPLADRVLIKVEDVADVTIGGVILPEAAKERPLSGTVVRCGPGRYDKDSEGKRKPMTIKVGDKVLYFKYAGDNME… |
| A0A7R9ZP34 | 97-192 | None |
| A0A0E0MAW5 | 94-197 | None |
| A0A284QP20 | 858-966 | None |
| A0A0G4HP09 | 203-343 | None |
| A0A6S8V3T8 | 46-153 | None |
| A0A0F9FS19 | 50-162 | None |
| A0A182FRQ6 | 50-156 | None |
| A0A0F9UJW5 | 82-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.