DPCstruct | MC8608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 134 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8UBB6 | 218-334 | VFLLSFCGLRNMYDVNSFRKIWVNEPGTPADTFTMQNYMSYCSQGMTQMSVASQNIFEVELPCTGTMANGVLVYSFNMSSTCGPIEQ… |
| A0A835WGQ0 | 2-126 | ASVDSSTDLVVLFIPVAFCDLAPAVSPEELRGILFGASTGDDNYNDAISSASGTVAGYFDFCSNGRRSLSPENTLISEAVTIPCNGS… |
| A8J9Y3 | 75-189 | None |
| A0A250WRF2 | 7-147 | None |
| A0A2P6TZ59 | 1-167 | None |
| A0A2P6VAQ8 | 686-826 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.