DPCstruct | MC8606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 134 ± 36 aa |
| Standard deviation of domain lengths | 35.77 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1V6D7 | 170-270 | NWSSAKFVASKLFQKNPNAYFYRHLEPGLTQNFGDWDENEKDIFLKIAKKYGCGDKWGIFSSYIPRRVGYQCANYYRQVIIPEGLII… |
| A0A836BY51 | 157-276 | GQFKRKITKADVPAQFRSKGWSEARAFAAGQLHKNPNAFFYRHPAPDREQATGEWTQEEHDLFVQTARKHGVGDKWGLFASYIPNRV… |
| A0A7S0NLC6 | 28-159 | None |
| K8EWP8 | 52-165 | None |
| A0A7S1NP95 | 267-518 | None |
| A0A1X2GUV4 | 31-187 | None |
| A0A1Y1WP10 | 127-244 | None |
| M1V4R4 | 194-317 | None |
| A0A1X0RL88 | 23-153 | None |
| A0A7J7IIS9 | 123-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.