DPCstruct | MC8603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Standard deviation of domain lengths | 12.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9GQ76 | 4-130 | LDPREDSFVLRVDKLVESVPLSCQADLIPSIFRFFEKYPLEDCGAPGTLVHLTEHFYPSYKDILLESLARAPSLNALLMVNRMLNSD… |
| S9SVE0 | 8-126 | YIYELEQLIERADKENDKYLFQDPAYEIMEEIEELDNAFEFVEPIFLLIERSPDIDFGGPGPFGSFLETFYHNGYEDVLVKSLQRKP… |
| A0A2V2S373 | 3-148 | None |
| T0PJB7 | 1-138 | None |
| F2L8A4 | 1-108 | None |
| A0A519MZ76 | 256-390 | None |
| A0A851GP81 | 12-149 | None |
| A0A315ANJ1 | 3-150 | None |
| F9N768 | 5-132 | None |
| A0A4Q5QPF9 | 4-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.