DPCstruct | MC8601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 32 aa |
| Standard deviation of domain lengths | 32.01 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06726 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8PL58 | 11-182 | THLPSFYCIILISTIFLSSCYWQPLPIDSPLTVPWSAEITTFRDALRAALGDDYDPALQIPQYIRPLDRCWCDLTDGMLEPFNVSQW… |
| A0A6A4II56 | 8-187 | FYCIILLATLFISTCYWSPISLDSALSEPWADNITTFGEALSFTLGPSYSKPLPTVFQPADRCWCDISTDGFFEPFSTSQWERLSVQ… |
| A0A5M3N4K8 | 33-226 | None |
| A0A1C7MQ57 | 6-207 | None |
| A0A4Y9ZJ58 | 34-249 | None |
| A0A166LZN3 | 25-230 | None |
| A0A4Y9Z8D0 | 17-262 | None |
| A0A5B1QGB6 | 33-301 | None |
| A0A0C2TTF1 | 2-173 | None |
| A0A067P1V2 | 7-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.