DPCstruct | MC8600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 305 ± 32 aa |
| Standard deviation of domain lengths | 31.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4IEY3 | 1-267 | MSDSFSETDSTFISTGSFSSTIPGIGALSGKAIKRFGSVVVKSVDAILIRRRLVQIEDVLGQRSDGMPDSCDIEALYSDLLELAAPS… |
| A0A0C3FQF2 | 11-310 | SFDSESFKSLPQRPPSILSLTTSTSANTVHISGIGALSGRIIYAVGEVAARGLENLAIRRRLGKITSAFPHQDYIAITDIETIYDHT… |
| A0A4S8M691 | 620-940 | None |
| A0A4S8M501 | 23-332 | None |
| A0A6A4HX74 | 1-261 | None |
| A0A6A4HM47 | 9-329 | None |
| A0A6A4H1V0 | 2-246 | None |
| A0A6A4H0K4 | 1-330 | None |
| A0A6A4GPD8 | 1-308 | None |
| A0A5C3M0R9 | 1-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.