DPCstruct | MC860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 267 ± 36 aa |
| Standard deviation of domain lengths | 36.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496VC76 | 1-209 | MPTLTQILFGSLLDNPTVVEVASKAGEKALSLVREHFTYSAYQITGATQESFSYALGAISIGVAAPDNKLGFTQKIFNAKITREFAE… |
| A0A176S6R2 | 1-292 | MSFNTIINTALSTLLKDGAIADFLVDKAGNKAIAIFQAHFTFSAFEIAKSYQDSYTYTIAAIGAGLATPEQKFSFLQKLTHSKVERE… |
| A0A496UYX1 | 1-326 | None |
| A0A849WPZ0 | 4-302 | None |
| A0A4E0RGH5 | 13-323 | None |
| A0A1W9W8S3 | 5-313 | None |
| A0A7C1W198 | 17-276 | None |
| A0A836W905 | 1-306 | None |
| A0A836SFY5 | 1-238 | None |
| A0A496W548 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.