DPCstruct | MC86
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A254QWF3 | 20-90 | SPSRVDRPVLVVSLPWGPSSEQIVQRADGRLLGPESAPLGVLATSDAPEFRSRLRAEGAILVIGASLIASI |
| A0A4S2H0Z8 | 25-102 | TSAPREGQAAIVFPPGWARGEVARATAEAGTALVRFGSLPNIAIVDLGRDDTARLREAGALLVLDPLILGGCLAGGPL |
| A0A2D6K3J5 | 1-85 | None |
| A0A0Y0G2R6 | 1-77 | None |
| A0A6N1VE86 | 1-80 | None |
| A0A7X6FV26 | 26-97 | None |
| A0A3S2VPN0 | 29-99 | None |
| V4RFQ6 | 27-101 | None |
| A0A3G2V280 | 5-78 | None |
| A0A085FK31 | 12-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.